PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_34860V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 299aa    MW: 32894 Da    PI: 4.5838
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_34860V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC55.51.3e-176861898
              NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                       ++++P arikki++ade+v +i+  +Pvl+ska elf+ +l  +++  +     +t+    ++++v+   +fdfl +iv +
  Pp3c3_34860V3.5.p  6 DTRFPAARIKKIMQADEEVGKIAMATPVLISKALELFLQNLCDKTYEITLRRGAKTMSSFHLKQCVQTNSVFDFLQEIVSK 86
                       5789*************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.9E-27272IPR009072Histone-fold
SuperFamilySSF471132.97E-20388IPR009072Histone-fold
PfamPF008081.2E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKKKLDTRFP AARIKKIMQA DEEVGKIAMA TPVLISKALE LFLQNLCDKT YEITLRRGAK  60
TMSSFHLKQC VQTNSVFDFL QEIVSKVPDI GTETTCDERN GGRRRKQSDG DDSDEEEVVK  120
RPKSEDQSTS GRGRGRGRGR GRGRGRGRGS NGTPSSRSNG VEKAEDSEDA EMDTYSPSPD  180
RENVILDPIV HKPRPKSEEA AARDASPTSS GHTKSPKLLG FDLNMDLDEN GEVAAGADEA  240
TVNEEEVEHD GSNVPTQDLD VDSENVLGGT LHLQRSELRP SLHPDEDDYD CEDEDEYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-22272575Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137147RGRGRGRGRGR
2139148RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S112_139V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-50nuclear factor Y, subunit C11